SCOPe 2.05: Domain d3o0gb_: 3o0g B:

Lineage for d3o0gb_ (3o0g B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
   Uniprot Q00535

8. Domain d3o0gb_: 3o0g B: [182721]
   Other proteins in same PDB: d3o0gd_, d3o0ge_
   automated match to d1unga_
   complexed with 3o0

Details for d3o0gb_

PDB Entry: 3o0g, 1.95 Å

PDB Description: crystal structure of cdk5:p25 in complex with an atp analogue

PDB Compounds: (B:) cell division protein kinase 5

SCOPe Domain Sequences for d3o0gb_:

Sequence, based on SEQRES records:

>d3o0gb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
klekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhknivr
lhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhr
dlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsidm
wsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypat
tslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsd

Sequence, based on observed residues (ATOM records):

>d3o0gb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
klekigtvfkaeivalkrvrpssalreicllkelkhknivrlhdvlhsdkkltlvfefcd
qdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqnllinrngelklan
fglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagcifaelanagrplfp
gndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnvvpklnatgrdllq
nllkcnpvqrisaeealqhpyfsd

Timeline for d3o0gb_:

• d3o0gb_ first appeared in SCOPe 2.01
  
• d3o0gb_ appears in SCOPe 2.04
  
• d3o0gb_ appears in SCOPe 2.06
  
• d3o0gb_ appears in the current release, SCOPe 2.08