Lineage for d3o0ga_ (3o0g A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219248Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2219249Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
    Uniprot Q00535
  8. 2219250Domain d3o0ga_: 3o0g A: [182720]
    Other proteins in same PDB: d3o0gd_, d3o0ge_
    automated match to d1unga_
    complexed with 3o0

Details for d3o0ga_

PDB Entry: 3o0g (more details), 1.95 Å

PDB Description: crystal structure of cdk5:p25 in complex with an atp analogue
PDB Compounds: (A:) cell division protein kinase 5

SCOPe Domain Sequences for d3o0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o0ga_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdf

SCOPe Domain Coordinates for d3o0ga_:

Click to download the PDB-style file with coordinates for d3o0ga_.
(The format of our PDB-style files is described here.)

Timeline for d3o0ga_: