Lineage for d3o0de_ (3o0d E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903304Species Yarrowia lipolytica [TaxId:4952] [189520] (2 PDB entries)
  8. 2903309Domain d3o0de_: 3o0d E: [182717]
    automated match to d1dt3a_
    complexed with k, mpd, mrd, nag

Details for d3o0de_

PDB Entry: 3o0d (more details), 1.7 Å

PDB Description: crystal structure of lip2 lipase from yarrowia lipolytica at 1.7 a resolution
PDB Compounds: (E:) triacylglycerol lipase

SCOPe Domain Sequences for d3o0de_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o0de_ c.69.1.0 (E:) automated matches {Yarrowia lipolytica [TaxId: 4952]}
vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
i

SCOPe Domain Coordinates for d3o0de_:

Click to download the PDB-style file with coordinates for d3o0de_.
(The format of our PDB-style files is described here.)

Timeline for d3o0de_: