SCOPe 2.07: Domain d3nzxs_: 3nzx S:

Lineage for d3nzxs_ (3nzx S:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3nzxs_: 3nzx S: [182708]
   Other proteins in same PDB: d3nzx1_, d3nzx2_, d3nzxb_, d3nzxc_, d3nzxd_, d3nzxf_, d3nzxg_, d3nzxh_, d3nzxi_, d3nzxj_, d3nzxk_, d3nzxl_, d3nzxm_, d3nzxn_, d3nzxp_, d3nzxq_, d3nzxr_, d3nzxt_, d3nzxu_, d3nzxv_, d3nzxw_, d3nzxx_, d3nzxy_, d3nzxz_
   automated match to d1g65e_

Details for d3nzxs_

PDB Entry: 3nzx, 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with ligand 2c

PDB Compounds: (S:) Proteasome component PRE5

SCOPe Domain Sequences for d3nzxs_:

Sequence; same for both SEQRES and ATOM records:

>d3nzxs_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

Timeline for d3nzxs_:

• d3nzxs_ first appeared in SCOPe 2.01
  
• d3nzxs_ appears in SCOPe 2.06
  
• d3nzxs_ appears in the current release, SCOPe 2.08