Lineage for d3nzwg_ (3nzw G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228451Domain d3nzwg_: 3nzw G: [182682]
    Other proteins in same PDB: d3nzw1_, d3nzwa_, d3nzwe_, d3nzwf_, d3nzwi_, d3nzwj_, d3nzwm_, d3nzwo_, d3nzws_, d3nzwt_, d3nzww_, d3nzwx_
    automated match to d1g65g_
    complexed with mes

Details for d3nzwg_

PDB Entry: 3nzw (more details), 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with 2b
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3nzwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzwg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3nzwg_:

Click to download the PDB-style file with coordinates for d3nzwg_.
(The format of our PDB-style files is described here.)

Timeline for d3nzwg_: