Class a: All alpha proteins [46456] (289 folds) |
Fold a.68: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47911] (1 superfamily) 5 helices; irregular array; left-handed superhelix |
Superfamily a.68.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47912] (1 family) |
Family a.68.1.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47913] (1 protein) |
Protein Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47914] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47915] (2 PDB entries) Uniprot P42768 241-309 |
Domain d1ej5a_: 1ej5 A: [18268] the polyproline region in this domain has been replaced by a short flexible linker |
PDB Entry: 1ej5 (more details)
SCOPe Domain Sequences for d1ej5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej5a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag
Timeline for d1ej5a_: