Lineage for d1ej5a_ (1ej5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330423Fold a.68: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47911] (1 superfamily)
    5 helices; irregular array; left-handed superhelix
  4. 2330424Superfamily a.68.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47912] (1 family) (S)
  5. 2330425Family a.68.1.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47913] (1 protein)
  6. 2330426Protein Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47914] (1 species)
  7. 2330427Species Human (Homo sapiens) [TaxId:9606] [47915] (2 PDB entries)
    Uniprot P42768 241-309
  8. 2330428Domain d1ej5a_: 1ej5 A: [18268]
    the polyproline region in this domain has been replaced by a short flexible linker

Details for d1ej5a_

PDB Entry: 1ej5 (more details)

PDB Description: solution structure of the autoinhibited conformation of wasp
PDB Compounds: (A:) wiskott-aldrich syndrome protein

SCOPe Domain Sequences for d1ej5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej5a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag

SCOPe Domain Coordinates for d1ej5a_:

Click to download the PDB-style file with coordinates for d1ej5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ej5a_: