SCOPe 2.08: Domain d1ej5a_: 1ej5 A:

Lineage for d1ej5a_ (1ej5 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.68: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47911] (1 superfamily)
   5 helices; irregular array; left-handed superhelix

4. Superfamily a.68.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47912] (1 family)

5. Family a.68.1.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47913] (1 protein)

6. Protein Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47914] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47915] (2 PDB entries)
   Uniprot P42768 241-309

8. Domain d1ej5a_: 1ej5 A: [18268]
   the polyproline region in this domain has been replaced by a short flexible linker

Details for d1ej5a_

PDB Entry: 1ej5

PDB Description: solution structure of the autoinhibited conformation of wasp

PDB Compounds: (A:) wiskott-aldrich syndrome protein

SCOPe Domain Sequences for d1ej5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ej5a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag

Timeline for d1ej5a_:

• d1ej5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ej5a_ appears in SCOPe 2.07