| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
| Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species) |
| Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (19 PDB entries) |
| Domain d3nzcx_: 3nzc X: [182655] automated match to d1cd2a_ complexed with d2o, gol, po4 |
PDB Entry: 3nzc (more details), 2 Å
SCOPe Domain Sequences for d3nzcx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nzcx_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl
Timeline for d3nzcx_: