Lineage for d3nz6x_ (3nz6 X:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511237Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)
  8. 2511258Domain d3nz6x_: 3nz6 X: [182651]
    automated match to d1cd2a_
    complexed with d2j, ndp

Details for d3nz6x_

PDB Entry: 3nz6 (more details), 2 Å

PDB Description: structural analysis of pneumocystis carinii and human dhfr complexes with nadph and a series of five potent 5-(omega-carboxy(alkyloxy) pyrido[2,3-d]pyrimidine derivatives
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3nz6x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nz6x_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

SCOPe Domain Coordinates for d3nz6x_:

Click to download the PDB-style file with coordinates for d3nz6x_.
(The format of our PDB-style files is described here.)

Timeline for d3nz6x_: