Lineage for d3nz4b_ (3nz4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010506Species Taxus canadensis [TaxId:88032] [189674] (1 PDB entry)
  8. 2010508Domain d3nz4b_: 3nz4 B: [182650]
    automated match to d1w27a_
    complexed with tca

Details for d3nz4b_

PDB Entry: 3nz4 (more details), 2.38 Å

PDB Description: Crystal Structure of a Taxus Phenylalanine Aminomutase
PDB Compounds: (B:) phenylalanine ammonia-lyase

SCOPe Domain Sequences for d3nz4b_:

Sequence, based on SEQRES records: (download)

>d3nz4b_ a.127.1.0 (B:) automated matches {Taxus canadensis [TaxId: 88032]}
srshvkdilglintfnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcs
swvqrkaedgadiygvttgfgacssrrtnqlselqeslircllagvftkgcassvdelpa
tvtrsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayia
glligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatalastvmyd
anvllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqdlsr
eyysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandral
hganfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdygl
kgldiamaaysselqylanpvtthvhsaeqhnqdinslalisarktdealdilklmiash
ltamcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcd
ptlplllglkqscfgsilalhkkdgietdtlvdrlaefekrlsdrlenemtavrvlyekk
ghktadnndalvriqgsrflpfyrfvrdeldtgvmsarreqtpqedvqkvfdaiadgrit
vpllhclqgflg

Sequence, based on observed residues (ATOM records): (download)

>d3nz4b_ a.127.1.0 (B:) automated matches {Taxus canadensis [TaxId: 88032]}
srshvkdilglintfnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcs
swvqrkaedgadiygvttgfgacssrrtnqlselqeslircllagvftkgcassvdelpa
tvtrsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayia
glligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatalastvmyd
anvllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqdlsr
eyysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandral
hganfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdygl
kgldiamaaysselqylanpvtthvhsaeqhnqdinslalisarktdealdilklmiash
ltamcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcd
ptlplllglkqscfgsilalhkkietdtlvdrlaefekrlsdrlenemtavrvlyekvri
qgsrflpfyrfvrdeldtgvmsarreqtpqedvqkvfdaiadgritvpllhclqgflg

SCOPe Domain Coordinates for d3nz4b_:

Click to download the PDB-style file with coordinates for d3nz4b_.
(The format of our PDB-style files is described here.)

Timeline for d3nz4b_: