Lineage for d3nz2k_ (3nz2 K:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557864Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1557865Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1558144Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1558145Protein automated matches [190967] (25 species)
    not a true protein
  7. 1558292Species Vibrio cholerae [TaxId:243277] [189429] (1 PDB entry)
  8. 1558303Domain d3nz2k_: 3nz2 K: [182647]
    automated match to d1ocxa_
    complexed with aco, acy, bu1, cl, gol, mg

Details for d3nz2k_

PDB Entry: 3nz2 (more details), 2.35 Å

PDB Description: Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor
PDB Compounds: (K:) Hexapeptide-repeat containing-acetyltransferase

SCOPe Domain Sequences for d3nz2k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nz2k_ b.81.1.0 (K:) automated matches {Vibrio cholerae [TaxId: 243277]}
mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
lkd

SCOPe Domain Coordinates for d3nz2k_:

Click to download the PDB-style file with coordinates for d3nz2k_.
(The format of our PDB-style files is described here.)

Timeline for d3nz2k_: