SCOPe 2.07: Domain d3nz2j1: 3nz2 J:2-184

Lineage for d3nz2j1 (3nz2 J:2-184)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (31 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189429] (1 PDB entry)

8. Domain d3nz2j1: 3nz2 J:2-184 [182646]
   Other proteins in same PDB: d3nz2b2, d3nz2j2
   automated match to d1ocxa_
   complexed with aco, acy, bu1, cl, gol, mg

Details for d3nz2j1

PDB Entry: 3nz2, 2.35 Å

PDB Description: Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor

PDB Compounds: (J:) Hexapeptide-repeat containing-acetyltransferase

SCOPe Domain Sequences for d3nz2j1:

Sequence; same for both SEQRES and ATOM records:

>d3nz2j1 b.81.1.0 (J:2-184) automated matches {Vibrio cholerae [TaxId: 243277]}
kmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghksc
vqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrq
awetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilr
slk

Timeline for d3nz2j1:

• d3nz2j1 first appeared in SCOPe 2.01, called d3nz2j_
  
• d3nz2j1 appears in SCOPe 2.06