Class b: All beta proteins [48724] (178 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (35 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189429] (1 PDB entry) |
Domain d3nz2d_: 3nz2 D: [182640] Other proteins in same PDB: d3nz2b2, d3nz2j2 automated match to d1ocxa_ complexed with aco, acy, bu1, cl, gol, mg |
PDB Entry: 3nz2 (more details), 2.35 Å
SCOPe Domain Sequences for d3nz2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nz2d_ b.81.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 243277]} mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs lkd
Timeline for d3nz2d_: