Lineage for d3nyla_ (3nyl A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)
  5. Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins)
    automatically mapped to Pfam PF12925
  6. Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [109846] (3 PDB entries)
    Uniprot P05067 374-569 # structures are known for other fragments: 28-123 (56494); 124-189 (89814); 287-344 (57371); 681-/-711 ((58608))
  8. Domain d3nyla_: 3nyl A: [182631]
    contains extra N-terminal alpha-hairpin

Details for d3nyla_

PDB Entry: 3nyl (more details), 2.8 Å

PDB Description: The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain
PDB Compounds: (A:) Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_b

SCOPe Domain Sequences for d3nyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nyla_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]}
tpdavdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkka
viqhfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhv
fnmlkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllyn
vpavaeeiqdevdell

SCOPe Domain Coordinates for d3nyla_ are not available.

Timeline for d3nyla_: