SCOPe 2.08: Domain d3nyla_: 3nyl A:

Lineage for d3nyla_ (3nyl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families)
   the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)

5. Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins)
   automatically mapped to Pfam PF12925

6. Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109846] (3 PDB entries)
   Uniprot P05067 374-569 # structures are known for other fragments: 28-123 (56494); 124-189 (89814); 287-344 (57371); 681-/-711 ((58608))

8. Domain d3nyla_: 3nyl A: [182631]
   contains extra N-terminal alpha-hairpin
   has additional insertions and/or extensions that are not grouped together

Details for d3nyla_

PDB Entry: 3nyl, 2.8 Å

PDB Description: The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain

PDB Compounds: (A:) Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_b

SCOPe Domain Sequences for d3nyla_:

Sequence; same for both SEQRES and ATOM records:

>d3nyla_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]}
tpdavdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkka
viqhfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhv
fnmlkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllyn
vpavaeeiqdevdell

Timeline for d3nyla_:

• d3nyla_ first appeared in SCOPe 2.01
  
• d3nyla_ appears in SCOPe 2.07