Class a: All alpha proteins [46456] (290 folds) |
Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965) |
Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins) automatically mapped to Pfam PF12925 |
Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109846] (3 PDB entries) Uniprot P05067 374-569 # structures are known for other fragments: 28-123 (56494); 124-189 (89814); 287-344 (57371); 681-/-711 ((58608)) |
Domain d3nyla_: 3nyl A: [182631] contains extra N-terminal alpha-hairpin has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3nyl (more details), 2.8 Å
SCOPe Domain Sequences for d3nyla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nyla_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]} tpdavdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkka viqhfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhv fnmlkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllyn vpavaeeiqdevdell
Timeline for d3nyla_: