SCOPe 2.06: Domain d3nyib1: 3nyi B:1-293

Lineage for d3nyib1 (3nyi B:1-293)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (10 species)
   not a true protein

7. Species Eubacterium ventriosum [TaxId:411463] [189476] (1 PDB entry)

8. Domain d3nyib1: 3nyi B:1-293 [182629]
   Other proteins in same PDB: d3nyib2
   automated match to d1pzxb_
   complexed with ste

Details for d3nyib1

PDB Entry: 3nyi, 1.9 Å

PDB Description: the crystal structure of a fat acid (stearic acid)-binding protein from eubacterium ventriosum atcc 27560.

PDB Compounds: (B:) fat acid-binding protein

SCOPe Domain Sequences for d3nyib1:

Sequence; same for both SEQRES and ATOM records:

>d3nyib1 c.119.1.0 (B:1-293) automated matches {Eubacterium ventriosum [TaxId: 411463]}
mykivsdsacdlskeylekhdvtivplsvsfdgetyyrdgvditrdecyqrmvddpklfp
ktslpsvesyadvfrsfveqgfpvvcftittlfsgsynsainakslvledypdanicvid
skqntvtqallidqfvrmledglsfeqamskldalmasarifftvgsldylkmggrigkv
ataatgklgvkpviimkdgdiglggigrnrnklknsvlqvakkyldennkdnfivsvgyg
ydkeegfefmkevestldvkldsetnvaigivsavhtgpypiglgvirkyetl

Timeline for d3nyib1:

• d3nyib1 first appeared in SCOPe 2.01, called d3nyib_
  
• d3nyib1 was called d3nyib_ in SCOPe 2.05
  
• d3nyib1 appears in SCOPe 2.07
  
• d3nyib1 appears in the current release, SCOPe 2.08