Lineage for d3nyda1 (3nyd A:1-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831376Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries)
  8. 2831384Domain d3nyda1: 3nyd A:1-303 [182626]
    Other proteins in same PDB: d3nyda2
    automated match to d1goka_
    complexed with 3ny, act, so4

Details for d3nyda1

PDB Entry: 3nyd (more details), 1.23 Å

PDB Description: Crystal Structure of Kemp Eliminase HG-2 Complexed with Transition State Analog 5-Nitro Benzotriazole
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3nyda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nyda1 c.1.8.3 (A:1-303) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgmvwpensmkwdatepsqgn
fnfagadylvnwaqqngkligggmlvwhsqlpswvssitdkntltnvmknhittlmtryk
gkirawdvvgeafnedgslrqtvflnvigedyipiafqtaraadpnaklyimdynldsas
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevsilmldv
agasptdyvnvvnaclnvqscvgisvfgvadpdswrasttpllfdgnfnpkpaynaivqd
lqq

SCOPe Domain Coordinates for d3nyda1:

Click to download the PDB-style file with coordinates for d3nyda1.
(The format of our PDB-style files is described here.)

Timeline for d3nyda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nyda2
View in 3D
Domains from other chains:
(mouse over for more information)
d3nydb_