![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
![]() | Domain d3ny5b1: 3ny5 B:153-235 [182621] Other proteins in same PDB: d3ny5a2, d3ny5b2, d3ny5c2, d3ny5d2 automated match to d1rfaa_ |
PDB Entry: 3ny5 (more details), 1.99 Å
SCOPe Domain Sequences for d3ny5b1:
Sequence, based on SEQRES records: (download)
>d3ny5b1 d.15.1.0 (B:153-235) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigwdt diswltgeelhvevlenvpltth
>d3ny5b1 d.15.1.0 (B:153-235) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqekkpigwdtdi swltgeelhvevlenvpltth
Timeline for d3ny5b1: