SCOPe 2.07: Domain d3ny5b1: 3ny5 B:153-235

Lineage for d3ny5b1 (3ny5 B:153-235)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (76 PDB entries)

8. Domain d3ny5b1: 3ny5 B:153-235 [182621]
   Other proteins in same PDB: d3ny5a2, d3ny5b2, d3ny5c2, d3ny5d2
   automated match to d1rfaa_

Details for d3ny5b1

PDB Entry: 3ny5, 1.99 Å

PDB Description: crystal structure of the rbd domain of serine/threonine-protein kinase b-raf from homo sapiens. northeast structural genomics consortium target hr4694f

PDB Compounds: (B:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d3ny5b1:

Sequence, based on SEQRES records:

>d3ny5b1 d.15.1.0 (B:153-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigwdt
diswltgeelhvevlenvpltth

Sequence, based on observed residues (ATOM records):

>d3ny5b1 d.15.1.0 (B:153-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqekkpigwdtdi
swltgeelhvevlenvpltth

Timeline for d3ny5b1:

• d3ny5b1 first appeared in SCOPe 2.01, called d3ny5b_
  
• d3ny5b1 appears in SCOPe 2.06