Lineage for d3ny5b1 (3ny5 B:153-235)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933266Domain d3ny5b1: 3ny5 B:153-235 [182621]
    Other proteins in same PDB: d3ny5a2, d3ny5b2, d3ny5c2, d3ny5d2
    automated match to d1rfaa_

Details for d3ny5b1

PDB Entry: 3ny5 (more details), 1.99 Å

PDB Description: crystal structure of the rbd domain of serine/threonine-protein kinase b-raf from homo sapiens. northeast structural genomics consortium target hr4694f
PDB Compounds: (B:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d3ny5b1:

Sequence, based on SEQRES records: (download)

>d3ny5b1 d.15.1.0 (B:153-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigwdt
diswltgeelhvevlenvpltth

Sequence, based on observed residues (ATOM records): (download)

>d3ny5b1 d.15.1.0 (B:153-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqekkpigwdtdi
swltgeelhvevlenvpltth

SCOPe Domain Coordinates for d3ny5b1:

Click to download the PDB-style file with coordinates for d3ny5b1.
(The format of our PDB-style files is described here.)

Timeline for d3ny5b1: