Lineage for d3nxad_ (3nxa D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 2711678Domain d3nxad_: 3nxa D: [182607]
    automated match to d1cfpa_

Details for d3nxad_

PDB Entry: 3nxa (more details), 2.1 Å

PDB Description: X-ray structure of the apo form of human S100A16
PDB Compounds: (D:) Protein S100-A16

SCOPe Domain Sequences for d3nxad_:

Sequence, based on SEQRES records: (download)

>d3nxad_ a.39.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadkli
qnldanhdgrisfdeywtliggitgpiakliheqe

Sequence, based on observed residues (ATOM records): (download)

>d3nxad_ a.39.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlgrisfdeywtlig
gitgpiakliheqe

SCOPe Domain Coordinates for d3nxad_:

Click to download the PDB-style file with coordinates for d3nxad_.
(The format of our PDB-style files is described here.)

Timeline for d3nxad_: