Lineage for d3nxac_ (3nxa C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 915090Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 915091Protein automated matches [190513] (5 species)
    not a true protein
  7. 915092Species Human (Homo sapiens) [TaxId:9606] [189519] (1 PDB entry)
  8. 915095Domain d3nxac_: 3nxa C: [182606]
    automated match to d1cfpa_

Details for d3nxac_

PDB Entry: 3nxa (more details), 2.1 Å

PDB Description: X-ray structure of the apo form of human S100A16
PDB Compounds: (C:) Protein S100-A16

SCOPe Domain Sequences for d3nxac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nxac_ a.39.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadkliq
nldanhdgrisfdeywtliggitgpiakliheqeqqs

SCOPe Domain Coordinates for d3nxac_:

Click to download the PDB-style file with coordinates for d3nxac_.
(The format of our PDB-style files is described here.)

Timeline for d3nxac_: