Lineage for d3nx8a_ (3nx8 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674055Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)
  8. 1674278Domain d3nx8a_: 3nx8 A: [182602]
    automated match to d1cmke_
    complexed with iph

Details for d3nx8a_

PDB Entry: 3nx8 (more details), 2 Å

PDB Description: human cAMP dependent protein kinase in complex with phenol
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3nx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nx8a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkngvndixnhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d3nx8a_:

Click to download the PDB-style file with coordinates for d3nx8a_.
(The format of our PDB-style files is described here.)

Timeline for d3nx8a_: