SCOPe 2.02: Domain d3nx6a_: 3nx6 A:

Lineage for d3nx6a_ (3nx6 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.0: automated matches [191639] (1 protein)
   not a true family

6. Protein automated matches [191176] (1 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [189427] (1 PDB entry)

8. Domain d3nx6a_: 3nx6 A: [182600]
   automated match to d1we3o_

Details for d3nx6a_

PDB Entry: 3nx6, 1.97 Å

PDB Description: Crystal Structure of co-chaperonin, GroES (Xoo4289) from Xanthomonas oryzae pv. oryzae KACC10331

PDB Compounds: (A:) 10kDa chaperonin

SCOPe Domain Sequences for d3nx6a_:

Sequence, based on SEQRES records:

>d3nx6a_ b.35.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
sikplhdrvvvkpieadevsaggivipdsakekstkgevvaigagkpldngslhapvvkv
gdkviygqyagssyksegveykvlreddilavig

Sequence, based on observed residues (ATOM records):

>d3nx6a_ b.35.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
sikplhdrvvvkpistkgevvaigagkpldngslhapvvkvgdkviygqyagssyksegv
eykvlreddilavig

Timeline for d3nx6a_:

• d3nx6a_ first appeared in SCOPe 2.01
  
• d3nx6a_ appears in SCOPe 2.03
  
• d3nx6a_ appears in the current release, SCOPe 2.08