Lineage for d3nwvd_ (3nwv D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980919Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1981083Species Human (Homo sapiens) [TaxId:9606] [109644] (9 PDB entries)
    Uniprot P99999
  8. 1981097Domain d3nwvd_: 3nwv D: [182596]
    automated match to d1j3sa_
    complexed with hem

Details for d3nwvd_

PDB Entry: 3nwv (more details), 1.9 Å

PDB Description: human cytochrome c g41s
PDB Compounds: (D:) cytochrome c

SCOPe Domain Sequences for d3nwvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nwvd_ a.3.1.1 (D:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d3nwvd_:

Click to download the PDB-style file with coordinates for d3nwvd_.
(The format of our PDB-style files is described here.)

Timeline for d3nwvd_: