Lineage for d3nw6a_ (3nw6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981821Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2981822Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2981832Domain d3nw6a_: 3nw6 A: [182590]
    automated match to d1m7na_
    complexed with lgw

Details for d3nw6a_

PDB Entry: 3nw6 (more details), 2.2 Å

PDB Description: Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (11A)
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3nw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nw6a_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
vyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvla
ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
yrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfv
megglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
k

SCOPe Domain Coordinates for d3nw6a_:

Click to download the PDB-style file with coordinates for d3nw6a_.
(The format of our PDB-style files is described here.)

Timeline for d3nw6a_: