| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) ![]() |
| Family d.278.1.1: H-NOX domain [111127] (2 proteins) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains automatically mapped to Pfam PF07700 |
| Protein Methyl-accepting chemotaxis protein [111128] (1 species) |
| Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries) Uniprot Q8RBX6 1-191 |
| Domain d3nvua_: 3nvu A: [182581] automated match to d1u4ha_ complexed with cl, hem, oxy |
PDB Entry: 3nvu (more details), 2.04 Å
SCOPe Domain Sequences for d3nvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvua_ d.278.1.1 (A:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtlvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatparliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfeykkn
Timeline for d3nvua_: