SCOPe 2.07: Domain d3nvrb_: 3nvr B:

Lineage for d3nvrb_ (3nvr B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.1: H-NOX domain [111127] (2 proteins)
   binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
   automatically mapped to Pfam PF07700

6. Protein Methyl-accepting chemotaxis protein [111128] (1 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries)
   Uniprot Q8RBX6 1-191

8. Domain d3nvrb_: 3nvr B: [182580]
   automated match to d1u4ha_
   complexed with cl, hem, oxy

Details for d3nvrb_

PDB Entry: 3nvr, 2.15 Å

PDB Description: Modulating Heme Redox Potential Through Protein-Induced Porphyrin Distortion

PDB Compounds: (B:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d3nvrb_:

Sequence; same for both SEQRES and ATOM records:

>d3nvrb_ d.278.1.1 (B:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtlvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikf

Timeline for d3nvrb_:

• d3nvrb_ first appeared in SCOPe 2.01
  
• d3nvrb_ appears in SCOPe 2.06
  
• d3nvrb_ appears in the current release, SCOPe 2.08