SCOPe 2.01: Domain d3nvrb_: 3nvr B:

Lineage for d3nvrb_ (3nvr B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (3 families)

5. Family d.278.1.1: H-NOX domain [111127] (2 proteins)
   binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains

6. Protein automated matches [191120] (2 species)
   not a true protein

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [189186] (6 PDB entries)

8. Domain d3nvrb_: 3nvr B: [182580]
   automated match to d1u4ha_
   complexed with cl, hem, oxy

Details for d3nvrb_

PDB Entry: 3nvr, 2.15 Å

PDB Description: Modulating Heme Redox Potential Through Protein-Induced Porphyrin Distortion

PDB Compounds: (B:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d3nvrb_:

Sequence; same for both SEQRES and ATOM records:

>d3nvrb_ d.278.1.1 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtlvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikf

Timeline for d3nvrb_:

• d3nvrb_ is new in SCOPe 2.01-stable
  
• d3nvrb_ appears in SCOPe 2.02
  
• d3nvrb_ appears in the current release, SCOPe 2.08