![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins) Pfam PF01474 |
![]() | Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries) Uniprot O53512 1-462 |
![]() | Domain d3nv8b1: 3nv8 B:1-462 [182578] Other proteins in same PDB: d3nv8b2 automated match to d2b7oa1 complexed with cl, gol, mn, pep, po4, so4 |
PDB Entry: 3nv8 (more details), 2.25 Å
SCOPe Domain Sequences for d3nv8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nv8b1 c.1.10.8 (B:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]} mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec lggaqdisetdlagryetacdprlntqqslelaflvaemlrd
Timeline for d3nv8b1: