SCOPe 2.04: Domain d3nv8b_: 3nv8 B:

Lineage for d3nv8b_ (3nv8 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
   Pfam PF01474

6. Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [141842] (5 PDB entries)
   Uniprot O53512 1-462

8. Domain d3nv8b_: 3nv8 B: [182578]
   automated match to d2b7oa1
   complexed with cl, gol, mn, pep, po4, so4

Details for d3nv8b_

PDB Entry: 3nv8, 2.25 Å

PDB Description: The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase in complex with phosphoenol pyruvate and manganese (thesit-free)

PDB Compounds: (B:) Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG

SCOPe Domain Sequences for d3nv8b_:

Sequence; same for both SEQRES and ATOM records:

>d3nv8b_ c.1.10.8 (B:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Timeline for d3nv8b_:

• d3nv8b_ first appeared in SCOPe 2.01
  
• d3nv8b_ appears in SCOPe 2.03
  
• d3nv8b_ appears in SCOPe 2.05
  
• d3nv8b_ appears in the current release, SCOPe 2.08, called d3nv8b1