Lineage for d3nv8b1 (3nv8 B:1-462)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835910Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
    Pfam PF01474
  6. 2835911Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 2835912Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries)
    Uniprot O53512 1-462
  8. 2835916Domain d3nv8b1: 3nv8 B:1-462 [182578]
    Other proteins in same PDB: d3nv8b2
    automated match to d2b7oa1
    complexed with cl, gol, mn, pep, po4, so4

Details for d3nv8b1

PDB Entry: 3nv8 (more details), 2.25 Å

PDB Description: The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase in complex with phosphoenol pyruvate and manganese (thesit-free)
PDB Compounds: (B:) Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG

SCOPe Domain Sequences for d3nv8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nv8b1 c.1.10.8 (B:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d3nv8b1:

Click to download the PDB-style file with coordinates for d3nv8b1.
(The format of our PDB-style files is described here.)

Timeline for d3nv8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nv8b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3nv8a_