Lineage for d3nv4a_ (3nv4 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308935Species Human (Homo sapiens) [TaxId:9606] [187655] (29 PDB entries)
  8. 1308961Domain d3nv4a_: 3nv4 A: [182576]
    automated match to d1a3ka_
    complexed with ni

Details for d3nv4a_

PDB Entry: 3nv4 (more details), 1.99 Å

PDB Description: crystal structure of human galectin-9 c-terminal crd in complex with sialyllactose
PDB Compounds: (A:) Galectin 9 short isoform variant

SCOPe Domain Sequences for d3nv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nv4a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpaypmpfittilgglypsksillsgtvlpsaqrfhinlcsgnhiafhlnprfdenavvr
ntqidnswgseerslprkmpfvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlpti
nrlevggdiqlthvqt

SCOPe Domain Coordinates for d3nv4a_:

Click to download the PDB-style file with coordinates for d3nv4a_.
(The format of our PDB-style files is described here.)

Timeline for d3nv4a_: