SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3nv1a_ (3nv1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (50 species)
    not a true protein
  7. 2044265Species Human (Homo sapiens) [TaxId:9606] [187655] (61 PDB entries)
  8. 2044271Domain d3nv1a_: 3nv1 A: [182573]
    automated match to d1a3ka_
    complexed with ni

Details for d3nv1a_

PDB Entry: 3nv1 (more details), 1.5 Å

PDB Description: Crystal structure of human galectin-9 C-terminal CRD
PDB Compounds: (A:) Galectin 9 short isoform variant

SCOPe Domain Sequences for d3nv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nv1a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpaypmpfittilgglypsksillsgtvlpsaqrfhinlcsgnhiafhlnprfdenavvr
ntqidnswgseerslprkmpfvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlpti
nrlevggdiqlthvqt

SCOPe Domain Coordinates for d3nv1a_:

Click to download the PDB-style file with coordinates for d3nv1a_.
(The format of our PDB-style files is described here.)

Timeline for d3nv1a_: