Lineage for d3nusa_ (3nus A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542317Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 2542318Species Human (Homo sapiens) [TaxId:9606] [90037] (25 PDB entries)
    Uniprot O15530 75-363
  8. 2542337Domain d3nusa_: 3nus A: [182567]
    automated match to d1h1wa_
    complexed with gol, jnz, so4

Details for d3nusa_

PDB Entry: 3nus (more details), 2.75 Å

PDB Description: phosphoinositide-dependent kinase-1 (pdk1) with fragment8
PDB Compounds: (A:) phosphoinositide-dependent kinase-1

SCOPe Domain Sequences for d3nusa_:

Sequence, based on SEQRES records: (download)

>d3nusa_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspe
llteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardl
vekllvldatkrlgceemegygplkahpffesvtwenlhqqtppkl

Sequence, based on observed residues (ATOM records): (download)

>d3nusa_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlssfvgtaqyvspellteksack
ssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvlda
tkrlgceemegygplkahpffesvtwenlhqqtppkl

SCOPe Domain Coordinates for d3nusa_:

Click to download the PDB-style file with coordinates for d3nusa_.
(The format of our PDB-style files is described here.)

Timeline for d3nusa_: