Lineage for d3nuea1 (3nue A:1-462)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086425Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 2086426Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries)
    Uniprot O53512 1-462
  8. 2086433Domain d3nuea1: 3nue A:1-462 [182556]
    Other proteins in same PDB: d3nuea2, d3nueb2
    automated match to d2b7oa1
    complexed with ce1, cl, gol, mn, po4, so4, trp

Details for d3nuea1

PDB Entry: 3nue (more details), 2.5 Å

PDB Description: The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with tryptophan
PDB Compounds: (A:) Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG

SCOPe Domain Sequences for d3nuea1:

Sequence, based on SEQRES records: (download)

>d3nuea1 c.1.10.8 (A:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Sequence, based on observed residues (ATOM records): (download)

>d3nuea1 c.1.10.8 (A:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgdgepqlfdlsahtvwigertrqidgahiafaqvian
pvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqv
iwqcdpmhgnthgfktrhfdrivdevqgffevhralgthpggihveitgenvtlggaqdi
lagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d3nuea1:

Click to download the PDB-style file with coordinates for d3nuea1.
(The format of our PDB-style files is described here.)

Timeline for d3nuea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nuea2