| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.143: SAICAR synthase-like [56103] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) ![]() shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies |
| Family d.143.1.0: automated matches [191445] (1 protein) not a true family |
| Protein automated matches [190664] (8 species) not a true protein |
| Species Clostridium perfringens [TaxId:195103] [189443] (1 PDB entry) |
| Domain d3nuaa1: 3nua A:1-235 [182554] Other proteins in same PDB: d3nuaa2, d3nuab2 automated match to d1kutb_ complexed with adp, amp, cit, gol |
PDB Entry: 3nua (more details), 1.4 Å
SCOPe Domain Sequences for d3nuaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nuaa1 d.143.1.0 (A:1-235) automated matches {Clostridium perfringens [TaxId: 195103]}
mvnqlemlyegkakkiyatdkedmvivhykddatafngekkaqieskgvlnneitslife
mlnkegikthfveklndrdqlckkveivplevivrnvaagsmakrlgleegyelkttvfe
lsykddslgdplindyhavgigattfeelnkiyeitakvneilkeafkkqninlidfkle
fgryngeilladeispdtcrfwdattgekmdkdrfrrdmgnvingyrevlnrlrn
Timeline for d3nuaa1: