![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53607] (80 PDB entries) |
![]() | Domain d3nu0a_: 3nu0 A: [182543] automated match to d1drfa_ complexed with 3tu, ndp, so4 |
PDB Entry: 3nu0 (more details), 1.35 Å
SCOPe Domain Sequences for d3nu0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nu0a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} vgslncivavsqnmgigkngdlpwpplrnefryfqrmtttssvegkqnlvimgkktwfsi peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe vyeknd
Timeline for d3nu0a_: