![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) ![]() |
![]() | Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins) |
![]() | Protein automated matches [191271] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189851] (1 PDB entry) |
![]() | Domain d3ntwc_: 3ntw C: [182538] Other proteins in same PDB: d3ntwa2 automated match to d1i2ta_ |
PDB Entry: 3ntw (more details), 2.6 Å
SCOPe Domain Sequences for d3ntwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ntwc_ a.144.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} algerlyprvqamqpafaskitgmllelspaqlllllasedslrarveeameliva
Timeline for d3ntwc_: