Lineage for d3ntwc_ (3ntw C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734856Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2734857Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 2734870Protein automated matches [191271] (2 species)
    not a true protein
  7. 2734886Species Norway rat (Rattus norvegicus) [TaxId:10116] [189851] (1 PDB entry)
  8. 2734888Domain d3ntwc_: 3ntw C: [182538]
    Other proteins in same PDB: d3ntwa2
    automated match to d1i2ta_

Details for d3ntwc_

PDB Entry: 3ntw (more details), 2.6 Å

PDB Description: structure of the mlle domain of edd in complex with a pam2 peptide from paip1
PDB Compounds: (C:) E3 ubiquitin-protein ligase UBR5

SCOPe Domain Sequences for d3ntwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ntwc_ a.144.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
algerlyprvqamqpafaskitgmllelspaqlllllasedslrarveeameliva

SCOPe Domain Coordinates for d3ntwc_:

Click to download the PDB-style file with coordinates for d3ntwc_.
(The format of our PDB-style files is described here.)

Timeline for d3ntwc_: