Lineage for d3nt9d_ (3nt9 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547280Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 2547308Domain d3nt9d_: 3nt9 D: [182536]
    automated match to d1uisa_

Details for d3nt9d_

PDB Entry: 3nt9 (more details), 1.99 Å

PDB Description: crystal structure of lssmkate1 red fluorescent proteins with large stokes shift
PDB Compounds: (D:) LSSmKate1 red fluorescent protein

SCOPe Domain Sequences for d3nt9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nt9d_ d.22.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3nt9d_:

Click to download the PDB-style file with coordinates for d3nt9d_.
(The format of our PDB-style files is described here.)

Timeline for d3nt9d_: