Lineage for d3nt9b_ (3nt9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940244Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 2940270Domain d3nt9b_: 3nt9 B: [182534]
    automated match to d1uisa_

Details for d3nt9b_

PDB Entry: 3nt9 (more details), 1.99 Å

PDB Description: crystal structure of lssmkate1 red fluorescent proteins with large stokes shift
PDB Compounds: (B:) LSSmKate1 red fluorescent protein

SCOPe Domain Sequences for d3nt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nt9b_ d.22.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3nt9b_:

Click to download the PDB-style file with coordinates for d3nt9b_.
(The format of our PDB-style files is described here.)

Timeline for d3nt9b_: