SCOPe 2.01: Domain d3nt3d_: 3nt3 D:

Lineage for d3nt3d_ (3nt3 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189424] (2 PDB entries)

8. Domain d3nt3d_: 3nt3 D: [182532]
   automated match to d1uisa_
   complexed with gol

Details for d3nt3d_

PDB Entry: 3nt3, 1.5 Å

PDB Description: crystal structure of lssmkate2 red fluorescent proteins with large stokes shift

PDB Compounds: (D:) LSSmKate2 red fluorescent protein

SCOPe Domain Sequences for d3nt3d_:

Sequence; same for both SEQRES and ATOM records:

>d3nt3d_ d.22.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggghlicnlkstyrskk
paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl

Timeline for d3nt3d_:

• d3nt3d_ is new in SCOPe 2.01-stable
  
• d3nt3d_ appears in SCOPe 2.02
  
• d3nt3d_ appears in the current release, SCOPe 2.08