Lineage for d3nsqa_ (3nsq A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 923849Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 923850Species Human (Homo sapiens) [TaxId:9606] [48511] (32 PDB entries)
    Uniprot P19793 227-458
  8. 923899Domain d3nsqa_: 3nsq A: [182524]
    automated match to d1lbda_
    complexed with chz

Details for d3nsqa_

PDB Entry: 3nsq (more details), 2.6 Å

PDB Description: Crystal structure of tetrameric RXRalpha-LBD complexed with antagonist danthron
PDB Compounds: (A:) Retinoid X receptor, alpha

SCOPe Domain Sequences for d3nsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nsqa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkli
gdtpidtflmeml

SCOPe Domain Coordinates for d3nsqa_:

Click to download the PDB-style file with coordinates for d3nsqa_.
(The format of our PDB-style files is described here.)

Timeline for d3nsqa_: