SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3nsqa_ (3nsq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009236Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2009237Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries)
    Uniprot P19793 227-458
  8. 2009289Domain d3nsqa_: 3nsq A: [182524]
    automated match to d1lbda_
    complexed with chz

Details for d3nsqa_

PDB Entry: 3nsq (more details), 2.6 Å

PDB Description: Crystal structure of tetrameric RXRalpha-LBD complexed with antagonist danthron
PDB Compounds: (A:) Retinoid X receptor, alpha

SCOPe Domain Sequences for d3nsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nsqa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkli
gdtpidtflmeml

SCOPe Domain Coordinates for d3nsqa_:

Click to download the PDB-style file with coordinates for d3nsqa_.
(The format of our PDB-style files is described here.)

Timeline for d3nsqa_: