SCOPe 2.01: Domain d3nslf_: 3nsl F:

Lineage for d3nslf_ (3nsl F:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (16 PDB entries)

8. Domain d3nslf_: 3nsl F: [182519]
   automated match to d1ksoa_
   complexed with gol; mutant

Details for d3nslf_

PDB Entry: 3nsl, 1.5 Å

PDB Description: Crystal Structure of S100A3 C30A+C68A double mutant expressed in insect cell

PDB Compounds: (F:) Protein S100-A3

SCOPe Domain Sequences for d3nslf_:

Sequence; same for both SEQRES and ATOM records:

>d3nslf_ a.39.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
ldtnkdaevdfveyvrslaclclycheyfkdcp

Timeline for d3nslf_:

• d3nslf_ is new in SCOPe 2.01-stable
  
• d3nslf_ appears in SCOPe 2.02
  
• d3nslf_ appears in the current release, SCOPe 2.08