SCOPe 2.03: Domain d3nsib_: 3nsi B:

Lineage for d3nsib_ (3nsi B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (20 PDB entries)

8. Domain d3nsib_: 3nsi B: [182511]
   automated match to d1ksoa_

Details for d3nsib_

PDB Entry: 3nsi, 2.15 Å

PDB Description: Crystal Structure of the Post-Refolded S100A3 Protein Expressed in Insect Cell

PDB Compounds: (B:) Protein S100-A3

SCOPe Domain Sequences for d3nsib_:

Sequence; same for both SEQRES and ATOM records:

>d3nsib_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfmsvl
dtnkdcevdfveyvrslaclclycheyfkdcpseppc

Timeline for d3nsib_:

• d3nsib_ first appeared in SCOPe 2.01
  
• d3nsib_ appears in SCOPe 2.02
  
• d3nsib_ appears in SCOPe 2.04
  
• d3nsib_ appears in the current release, SCOPe 2.08