Lineage for d3nrul_ (3nru L:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305041Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1305055Protein automated matches [190969] (1 species)
    not a true protein
  7. 1305056Species Human (Homo sapiens) [TaxId:9606] [188606] (8 PDB entries)
  8. 1305075Domain d3nrul_: 3nru L: [182503]
    automated match to d1kgya_
    complexed with cl, so4

Details for d3nrul_

PDB Entry: 3nru (more details), 2.3 Å

PDB Description: Ligand binding domain of EPHA7
PDB Compounds: (L:) Ephrin receptor

SCOPe Domain Sequences for d3nrul_:

Sequence, based on SEQRES records: (download)

>d3nrul_ b.18.1.4 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwis
kgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtiaa
desftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyy

Sequence, based on observed residues (ATOM records): (download)

>d3nrul_ b.18.1.4 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllldskaewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgnaq
rifvelkftlrdcnslpggtcketfnlyyyetddtirenlyvkidtiaadesftkmklnt
evreigplskkgfylafqdvgacialvsvkvyy

SCOPe Domain Coordinates for d3nrul_:

Click to download the PDB-style file with coordinates for d3nrul_.
(The format of our PDB-style files is described here.)

Timeline for d3nrul_: