Lineage for d3nruj_ (3nru J:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777058Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1777072Protein automated matches [190969] (1 species)
    not a true protein
  7. 1777073Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 1777090Domain d3nruj_: 3nru J: [182501]
    automated match to d1kgya_
    complexed with cl, so4

Details for d3nruj_

PDB Entry: 3nru (more details), 2.3 Å

PDB Description: Ligand binding domain of EPHA7
PDB Compounds: (J:) Ephrin receptor

SCOPe Domain Sequences for d3nruj_:

Sequence, based on SEQRES records: (download)

>d3nruj_ b.18.1.4 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwi
skgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtia
adesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykk

Sequence, based on observed residues (ATOM records): (download)

>d3nruj_ b.18.1.4 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwi
skgnaqrifvelkftlrdcnslplgtcketfnlyyyetdydtgrnirenlyvkidtiaad
esklntevreigplskkgfylafqdvgacialvsvkvyykk

SCOPe Domain Coordinates for d3nruj_:

Click to download the PDB-style file with coordinates for d3nruj_.
(The format of our PDB-style files is described here.)

Timeline for d3nruj_: