SCOPe 2.06: Domain d3nrue1: 3nru E:32-204

Lineage for d3nrue1 (3nru E:32-204)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein automated matches [190969] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)

8. Domain d3nrue1: 3nru E:32-204 [182496]
   Other proteins in same PDB: d3nruc2, d3nrud2, d3nrue2, d3nruf2, d3nrug2, d3nruh2, d3nrui2, d3nruj2, d3nruk2
   automated match to d1kgya_
   complexed with cl, so4

Details for d3nrue1

PDB Entry: 3nru, 2.3 Å

PDB Description: Ligand binding domain of EPHA7

PDB Compounds: (E:) Ephrin receptor

SCOPe Domain Sequences for d3nrue1:

Sequence, based on SEQRES records:

>d3nrue1 b.18.1.4 (E:32-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwis
kgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtiaa
desftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykk

Sequence, based on observed residues (ATOM records):

>d3nrue1 b.18.1.4 (E:32-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllldskaqqewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgn
aqrifvelkftlrdcnslpgvgtcketfnlyyyetdydtgrnirenlyvkidtiaadesf
tkmklntevreigplskkgfylafqdvgacialvsvkvyykk

Timeline for d3nrue1:

• d3nrue1 first appeared in SCOPe 2.01, called d3nrue_
  
• d3nrue1 was called d3nrue_ in SCOPe 2.05
  
• d3nrue1 appears in SCOPe 2.07
  
• d3nrue1 appears in the current release, SCOPe 2.08