Lineage for d3nrud_ (3nru D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942170Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
  6. 942184Protein automated matches [190969] (1 species)
    not a true protein
  7. 942185Species Human (Homo sapiens) [TaxId:9606] [188606] (6 PDB entries)
  8. 942193Domain d3nrud_: 3nru D: [182495]
    automated match to d1kgya_
    complexed with cl, so4

Details for d3nrud_

PDB Entry: 3nru (more details), 2.3 Å

PDB Description: Ligand binding domain of EPHA7
PDB Compounds: (D:) Ephrin receptor

SCOPe Domain Sequences for d3nrud_:

Sequence, based on SEQRES records: (download)

>d3nrud_ b.18.1.4 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwi
skgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtia
adesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykk

Sequence, based on observed residues (ATOM records): (download)

>d3nrud_ b.18.1.4 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwi
skgnaqrifvelkftlrdcnslpgvcketfnlyyyetdydtgrnirenlyvkidtiaade
sklntevreigplskkgfylafqdvgacialvsvkvyykk

SCOPe Domain Coordinates for d3nrud_:

Click to download the PDB-style file with coordinates for d3nrud_.
(The format of our PDB-style files is described here.)

Timeline for d3nrud_: