Lineage for d3nrud1 (3nru D:32-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774192Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 2774206Protein automated matches [190969] (1 species)
    not a true protein
  7. 2774207Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 2774216Domain d3nrud1: 3nru D:32-204 [182495]
    Other proteins in same PDB: d3nruc2, d3nrud2, d3nrue2, d3nruf2, d3nrug2, d3nruh2, d3nrui2, d3nruj2, d3nruk2
    automated match to d1kgya_
    complexed with cl, so4

Details for d3nrud1

PDB Entry: 3nru (more details), 2.3 Å

PDB Description: Ligand binding domain of EPHA7
PDB Compounds: (D:) Ephrin receptor

SCOPe Domain Sequences for d3nrud1:

Sequence, based on SEQRES records: (download)

>d3nrud1 b.18.1.4 (D:32-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwis
kgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtiaa
desftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykk

Sequence, based on observed residues (ATOM records): (download)

>d3nrud1 b.18.1.4 (D:32-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwis
kgnaqrifvelkftlrdcnslpgvcketfnlyyyetdydtgrnirenlyvkidtiaades
klntevreigplskkgfylafqdvgacialvsvkvyykk

SCOPe Domain Coordinates for d3nrud1:

Click to download the PDB-style file with coordinates for d3nrud1.
(The format of our PDB-style files is described here.)

Timeline for d3nrud1: