SCOPe 2.01: Domain d3nqmb_: 3nqm B:

Lineage for d3nqmb_ (3nqm B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (9 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (9 PDB entries)

8. Domain d3nqmb_: 3nqm B: [182487]
   automated match to d1dv7a_
   complexed with bmp, gol; mutant

Details for d3nqmb_

PDB Entry: 3nqm, 1.32 Å

PDB Description: Crystal structure of the mutant V155S of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3nqmb_:

Sequence; same for both SEQRES and ATOM records:

>d3nqmb_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknysgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesikdll

Timeline for d3nqmb_:

• d3nqmb_ is new in SCOPe 2.01-stable
  
• d3nqmb_ appears in SCOPe 2.02
  
• d3nqmb_ appears in the current release, SCOPe 2.08