![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein automated matches [190130] (11 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries) |
![]() | Domain d3nq7b_: 3nq7 B: [182471] automated match to d1dv7a_ complexed with bmp, gol; mutant |
PDB Entry: 3nq7 (more details), 1.44 Å
SCOPe Domain Sequences for d3nq7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nq7b_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii adakvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd pgetlrfadaiivgrsiyladnpaaaaagiiesikdll
Timeline for d3nq7b_: